PLF4_HUMAN   P02776


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P02776

Recommended name:Platelet factor 4

EC number:

Alternative names:(PF-4) (C-X-C motif chemokine 4) (Iroplact) (Oncostatin-A)

Cleaved into:Platelet factor 4, short form (Endothelial cell growth inhibitor)

GeneID:5196

Gene names  (primary ):PF4

Gene names  (synonym ):CXCL4 SCYB4

Gene names  (ORF ):

Length:101

Mass:10845

Sequence:MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Tissue specificity:

Induction:

Developmental stage:

Protein families:Intercrine alpha (chemokine CxC) family


   💬 WhatsApp