VIP_HUMAN   P01282


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P01282

Recommended name:VIP peptides [Cleaved into: Intestinal peptide PHV-42

EC number:

Alternative names:(Peptide histidine valine 42); Intestinal peptide PHM-27(Peptide histidine methioninamide 27); Vasoactive intestinal peptide(VIP) (Vasoactive intestinal polypeptide)]

Cleaved into:Intestinal peptide PHV-42 (Peptide histidine valine 42); Intestinal peptide PHM-27 (Peptide histidine methioninamide 27); Vasoactive intestinal peptide (VIP) (Vasoactive intestinal polypeptide)

GeneID:7432

Gene names  (primary ):VIP

Gene names  (synonym ):

Gene names  (ORF ):

Length:170

Mass:19169

Sequence:MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK

Tissue specificity:

Induction:

Developmental stage:

Protein families:Glucagon family


   💬 WhatsApp