PEBP1_HUMAN   P30086


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P30086

Recommended name:Phosphatidylethanolamine-binding protein 1

EC number:

Alternative names:(PEBP-1) (HCNPpp) (Neuropolypeptide h3) (Prostatic-binding protein) (Raf kinase inhibitor protein) (RKIP)

Cleaved into:Hippocampal cholinergic neurostimulating peptide (HCNP)

GeneID:5037

Gene names  (primary ):PEBP1

Gene names  (synonym ):PBP PEBP

Gene names  (ORF ):

Length:187

Mass:21057

Sequence:MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

Tissue specificity:

Induction:

Developmental stage:

Protein families:Phosphatidylethanolamine-binding protein family


   💬 WhatsApp