PPCT_HUMAN Q9UKL6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UKL6
Recommended name：Phosphatidylcholine transfer protein
EC number：
Alternative names：(PC-TP) (START domain-containing protein 2) (StARD2) (StAR-related lipid transfer protein 2)
Cleaved into：
GeneID：58488
Gene names (primary )：PCTP
Gene names (synonym )：STARD2
Gene names (ORF )：
Length：214
Mass：24843
Sequence：MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT
Tissue specificity：Highest expression in liver, placenta, testis, kidney and heart. Low levels in brain and lung. No expression detected in thymus. {ECO:0000269|PubMed:10542325}.
Induction：
Developmental stage：
Protein families：