PATE2_HUMAN Q6UY27
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6UY27
Recommended name：Prostate and testis expressed protein 2
EC number：
Alternative names：(PATE-like protein M) (PATE-M)
Cleaved into：
GeneID：399967
Gene names (primary )：PATE2
Gene names (synonym )：C11orf38
Gene names (ORF )：UNQ3112/PRO10144
Length：113
Mass：13015
Sequence：MLVLFLLGTVFLLCPYWGELHDPIKATEIMCYECKKYHLGLCYGVMTSCSLKHKQSCAVENFYILTRKGQSMYHYSKLSCMTSCEDINFLGFTKRVELICCDHSNYCNLPEGV
Tissue specificity：Isoform 1 and isoform 2 are expressed in prostate and testis. Isoform 2 is expressed in male and female brain at equivalent levels, in particular in cerebellum, cerebral cortex, corpus callosum, occipital, parrietal and temporal lobes, and pons, but not in amygdala, cerebral peduncle, hippocampus and thalamus. {ECO:0000269|PubMed:18387948}.
Induction：
Developmental stage：
Protein families：PATE family