PATE4_HUMAN   P0C8F1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0C8F1

Recommended name:Prostate and testis expressed protein 4

EC number:

Alternative names:(PATE-like protein B) (PATE-B)

Cleaved into:

GeneID:399968

Gene names  (primary ):PATE4

Gene names  (synonym ):

Gene names  (ORF ):

Length:98

Mass:11407

Sequence:MRKMNTLLLVSLSFLYLKEVMGLKCNTCIYTEGWKCMAGRGTCIAKENELCSTTAYFRGDKHMYSTHMCKYKCREEESSKRGLLRVTLCCDRNFCNVF

Tissue specificity:Specifically expressed in prostate, testis and spinal cord. Present in the acrosomal region of sperm cells. Present in apical epithelial cells of prostatic duct. {ECO:0000269|PubMed:18387948}.

Induction:

Developmental stage:

Protein families:PATE family


   💬 WhatsApp