BPIA2_HUMAN Q96DR5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96DR5
Recommended name：BPI fold-containing family A member 2
EC number：
Alternative names：(Parotid secretory protein) (PSP) (Short palate, lung and nasal epithelium carcinoma-associated protein 2)
Cleaved into：
GeneID：140683
Gene names (primary )：BPIFA2
Gene names (synonym )：C20orf70 SPLUNC2
Gene names (ORF )：UNQ510/PRO1025
Length：249
Mass：27011
Sequence：MLQLWKLVLLCGVLTGTSESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI
Tissue specificity：Detected in submandibular gland. Secreted into saliva. {ECO:0000269|PubMed:11971875, ECO:0000269|PubMed:24581853}.
Induction：
Developmental stage：
Protein families：BPI/LBP/Plunc superfamily, Plunc family