OX26_HUMAN P83859
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P83859
Recommended name：Orexigenic neuropeptide QRFP
EC number：
Alternative names：(P518)
Cleaved into：QRF-amide (Neuropeptide RF-amide) (Pyroglutamylated arginine-phenylalanine-amide peptide)
GeneID：347148
Gene names (primary )：QRFP
Gene names (synonym )：
Gene names (ORF )：
Length：136
Mass：14941
Sequence：MVRPYPLIYFLFLPLGACFPLLDRREPTDAMGGLGAGERWADLAMGPRPHSVWGSSRWLRASQPQALLVIARGLQTSGREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFRFGRR
Tissue specificity：Expressed widely in the brain with highest expression levels in the cerebellum, medulla, pituitary, retina, vestibular nucleus, and white matter. Also expressed in the bladder, colon, coronary artery, parathyroid gland, prostate, testis, and thyroid. {ECO:0000269|PubMed:12714592}.
Induction：
Developmental stage：
Protein families：RFamide neuropeptide family