SPIN1_HUMAN   Q9Y657


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y657

Recommended name:Spindlin-1

EC number:

Alternative names:(Ovarian cancer-related protein) (Spindlin1)

Cleaved into:

GeneID:10927

Gene names  (primary ):SPIN1

Gene names  (synonym ):OCR SPIN

Gene names  (ORF ):

Length:262

Mass:29601

Sequence:MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS

Tissue specificity:Highly expressed in ovarian cancer tissues. {ECO:0000269|PubMed:22258766}.

Induction:

Developmental stage:

Protein families:SPIN/STSY family


   💬 WhatsApp