ODF3A_HUMAN Q96PU9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96PU9
Recommended name：Outer dense fiber protein 3
EC number：
Alternative names：(Outer dense fiber of sperm tails protein 3) (Sperm tail protein SHIPPO 1) (Transcript induced in spermiogenesis protein 50)
Cleaved into：
GeneID：113746
Gene names (primary )：ODF3
Gene names (synonym )：SHIPPO1 TISP50
Gene names (ORF )：
Length：254
Mass：27710
Sequence：MTEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLLAENCSPGPRYNVNPKILRTGKDLGPAYSILGRYQTKTMLTPGPGDYFPEKSTKYVFDSAPSHSISARTKAFRVDSTPGPAAYMLPMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTPGPAAYRQTDVRVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTLTKPCAPVVTFGIKHSDYMTPLLVDVE
Tissue specificity：Testis-specific. {ECO:0000269|PubMed:11870087, ECO:0000269|Ref.2}.
Induction：
Developmental stage：
Protein families：ODF3 family