T4S19_HUMAN   Q96DZ7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96DZ7

Recommended name:Transmembrane 4 L6 family member 19

EC number:

Alternative names:(Osteoclast maturation-associated gene 4 protein) (Tetraspan membrane protein OCTM4)

Cleaved into:

GeneID:116211

Gene names  (primary ):TM4SF19

Gene names  (synonym ):OCTM4

Gene names  (ORF ):

Length:209

Mass:22433

Sequence:MVSSPCTQASSRTCSRILGLSLGTAALFAAGANVALLLPNWDVTYLLRGLLGRHAMLGTGLWGGGLMVLTAAILISLMGWRYGCFSKSGLCRSVLTALLSGGLALLGALICFVTSGVALKDGPFCMFDVSSFNQTQAWKYGYPFKDLHSRNYLYDRSLWNSVCLEPSAAVVWHVSLFSALLCISLLQLLLVVVHVINSLLGLFCSLCEK

Tissue specificity:

Induction:

Developmental stage:

Protein families:L6 tetraspanin family


   💬 WhatsApp