OR8D1_HUMAN   Q8WZ84


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8WZ84

Recommended name:Olfactory receptor 8D1

EC number:

Alternative names:(OST004) (Olfactory receptor 8D3) (Olfactory receptor OR11-301) (Olfactory receptor-like protein JCG9)

Cleaved into:

GeneID:283159

Gene names  (primary ):OR8D1

Gene names  (synonym ):OR8D3

Gene names  (ORF ):

Length:308

Mass:34445

Sequence:MTMENYSMAAQFVLDGLTQQAELQLPLFLLFLGIYVVTVVGNLGMILLIAVSPLLHTPMYYFLSSLSFVDFCYSSVITPKMLVNFLGKKNTILYSECMVQLFFFVVFVVAEGYLLTAMAYDRYVAICSPLLYNAIMSSWVCSLLVLAAFFLGFLSALTHTSAMMKLSFCKSHIINHYFCDVLPLLNLSCSNTHLNELLLFIIAGFNTLVPTLAVAVSYAFILYSILHIRSSEGRSKAFGTCSSHLMAVVIFFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKALRKVLVGK

Tissue specificity:Expressed in the tongue.

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp