PNOC_HUMAN   Q13519


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q13519

Recommended name:Prepronociceptin [Cleaved into: Nocistatin; Nociceptin

EC number:

Alternative names:(Orphanin FQ) (PPNOC); Orphanin FQ2]

Cleaved into:Nocistatin; Nociceptin (Orphanin FQ) (PPNOC); Orphanin FQ2

GeneID:5368

Gene names  (primary ):PNOC

Gene names  (synonym ):OFQ

Gene names  (ORF ):

Length:176

Mass:20295

Sequence:MKVLLCDLLLLSLFSSVFSSCQRDCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTPCTKVMARSSWQLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV

Tissue specificity:Predominantly expressed in the brain and spinal cord. Also expressed and secreted by peripheral blood neutrophils following degranulation. {ECO:0000269|PubMed:12950177}.

Induction:

Developmental stage:

Protein families:Opioid neuropeptide precursor family


   💬 WhatsApp