TCL1A_HUMAN   P56279


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P56279

Recommended name:T-cell leukemia/lymphoma protein 1A

EC number:

Alternative names:(Oncogene TCL-1) (Oncogene TCL1) (Protein p14 TCL1)

Cleaved into:

GeneID:8115

Gene names  (primary ):TCL1A

Gene names  (synonym ):TCL1

Gene names  (ORF ):

Length:114

Mass:13460

Sequence:MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

Tissue specificity:Restricted in the T-cell lineage to immature thymocytes and activated peripheral lymphocytes. Preferentially expressed early in T- and B-lymphocyte differentiation.

Induction:

Developmental stage:

Protein families:TCL1 family


   💬 WhatsApp