O13C6_HUMAN   Q8NH95


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8NH95

Recommended name:Putative olfactory receptor 13C6

EC number:

Alternative names:(Olfactory receptor, family 13, subfamily C, member 6 pseudogene) (Olfactory receptor, family 13, subfamily C, member 7 pseudogene) (Putative olfactory receptor 13C7)

Cleaved into:

GeneID:

Gene names  (primary ):OR13C6P

Gene names  (synonym ):

Gene names  (ORF ):

Length:151

Mass:16702

Sequence:MVSANQTASVTEFILLGLSAHPKLEKTFFVLILLMYLVILLGNGVLILMTVSNSHLHMPMYFFLGNLSFLDICYTTSSVPLILDSFLTPRKTISFSACAVQMFLSFAMGATECVLLSMMAFDRYVAICNPLRYPVVMSKAAYMPIRLPAPG

Tissue specificity:

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp