O4F17_HUMAN   Q8NGA8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8NGA8

Recommended name:Olfactory receptor 4F17

EC number:

Alternative names:(Olfactory receptor 4F11) (Olfactory receptor 4F18) (Olfactory receptor 4F19)

Cleaved into:

GeneID:81099

Gene names  (primary ):OR4F17

Gene names  (synonym ):OR4F11P OR4F18 OR4F19

Gene names  (ORF ):

Length:305

Mass:34212

Sequence:MVTEFIFLGLSDSQGLQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLSLIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAICKPLHYTTIMCGNACVGIMAVAWGIGFLHSVSQLAFAVHLPFCGPNEVDSFYCDLPRVIKLACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHRPLDKSSKALSTLTAHITVVLLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRQLRKWDAHSSVKF

Tissue specificity:

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp