OR2C3_HUMAN   Q8N628


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8N628

Recommended name:Olfactory receptor 2C3

EC number:

Alternative names:(Olfactory receptor 2C4) (Olfactory receptor 2C5) (Olfactory receptor OR1-30)

Cleaved into:

GeneID:81472

Gene names  (primary ):OR2C3

Gene names  (synonym ):OR2C4 OR2C5P

Gene names  (ORF ):

Length:320

Mass:35376

Sequence:MMEIANVSSPEVFVLLGFSTRPSLETVLFIVVLSFYMVSILGNGIIILVSHTDVHLHTPMYFFLANLPFLDMSFTTSIVPQLLANLWGPQKTISYGGCVVQFYISHWLGATECVLLATMSYDRYAAICRPLHYTVIMHPQLCLGLALASWLGGLTTSMVGSTLTMLLPLCGNNCIDHFFCEMPLIMQLACVDTSLNEMEMYLASFVFVVLPLGLILVSYGHIARAVLKIRSAEGRRKAFNTCSSHVAVVSLFYGSIIFMYLQPAKSTSHEQGKFIALFYTVVTPALNPLIYTLRNTEVKSALRHMVLENCCGSAGKLAQI

Tissue specificity:

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp