OBAS1_HUMAN   Q96MR7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96MR7

Recommended name:Putative uncharacterized protein OBSCN-AS1

EC number:

Alternative names:(OBSCN antisense RNA 1) (OBSCN antisense gene protein 1)

Cleaved into:

GeneID:

Gene names  (primary ):OBSCN-AS1

Gene names  (synonym ):C1orf145

Gene names  (ORF ):

Length:158

Mass:17524

Sequence:MYTASSSAETLRTVRRRSVPSSSMPYLALAHNRVSSLNHAASVDGWGTSHRNVADSFSRTSRSCSRFLKGTAGSARREDWNGHLQPWIPRPDRRGWETADRKGERTQVHGLRRSLGPRAPHPGAHRALRPAQSCRSGPRGWTPCRCRGRGPTACRRGS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp