TIRR_HUMAN   Q9BRJ7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BRJ7

Recommended name:Tudor-interacting repair regulator protein

EC number:

Alternative names:(NUDT16-like protein 1) (Protein syndesmos)

Cleaved into:

GeneID:84309

Gene names  (primary ):NUDT16L1

Gene names  (synonym ):SDOS TIRR

Gene names  (ORF ):

Length:211

Mass:23338

Sequence:MSTAAVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLLPASS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Nudix hydrolase family, TIRR subfamily


   💬 WhatsApp