SPXN1_HUMAN   Q5VSR9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5VSR9

Recommended name:Sperm protein associated with the nucleus on the X chromosome N1

EC number:

Alternative names:(Nuclear-associated protein SPAN-Xn1) (SPANX-N1) (SPANX family member N1)

Cleaved into:

GeneID:494118

Gene names  (primary ):SPANXN1

Gene names  (synonym ):

Gene names  (ORF ):

Length:72

Mass:8263

Sequence:MEQPTSSINGEKRKSPCESNNENDEMQETPNRDLAPEPSLKKMKTSEYSTVLAFCYRKAKKIHSNQLENDQS

Tissue specificity:

Induction:

Developmental stage:

Protein families:SPAN-X family


   💬 WhatsApp