NRK1_HUMAN   Q9NWW6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NWW6

Recommended name:Nicotinamide riboside kinase 1

EC number:EC:2.7.1.22

Alternative names:(NRK 1) (NmR-K 1) (Nicotinic acid riboside kinase 1) (Ribosylnicotinamide kinase 1) (RNK 1) (Ribosylnicotinic acid kinase 1)

Cleaved into:

GeneID:54981

Gene names  (primary ):NMRK1

Gene names  (synonym ):C9orf95 NRK1

Gene names  (ORF ):

Length:199

Mass:23193

Sequence:MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA

Tissue specificity:

Induction:

Developmental stage:

Protein families:Uridine kinase family, NRK subfamily


   💬 WhatsApp