NRBF2_HUMAN   Q96F24


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96F24

Recommended name:Nuclear receptor-binding factor 2

EC number:

Alternative names:(NRBF-2) (Comodulator of PPAR and RXR)

Cleaved into:

GeneID:29982

Gene names  (primary ):NRBF2

Gene names  (synonym ):COPR

Gene names  (ORF ):

Length:287

Mass:32378

Sequence:MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN

Tissue specificity:Detected in keratinocytes, liver and placenta (PubMed:15610520). Expressed in a subset of cells in pediatric medulloblastoma (PubMed:18619852). {ECO:0000269|PubMed:15610520, ECO:0000269|PubMed:18619852}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp