HMGN4_HUMAN   O00479


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O00479

Recommended name:High mobility group nucleosome-binding domain-containing protein 4

EC number:

Alternative names:(Non-histone chromosomal protein HMG-17-like 3) (Non-histone chromosomal protein)

Cleaved into:

GeneID:10473

Gene names  (primary ):HMGN4

Gene names  (synonym ):HMG17L3 NHC

Gene names  (ORF ):

Length:90

Mass:9539

Sequence:MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK

Tissue specificity:

Induction:

Developmental stage:

Protein families:HMGN family


   💬 WhatsApp