IKBD_HUMAN   Q8NI38


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8NI38

Recommended name:NF-kappa-B inhibitor delta

EC number:

Alternative names:(NFKB inhibitor delta) (I-kappa-B-delta) (IkB-delta) (IkappaBdelta) (IkappaBNS) (T-cell activation NFKB-like protein) (TA-NFKBH)

Cleaved into:

GeneID:84807

Gene names  (primary ):NFKBID

Gene names  (synonym ):IKBNS

Gene names  (ORF ):

Length:313

Mass:33481

Sequence:MEAGPWRVSAPPSGPPQFPAVVPGPSLEVARAHMLALGPQQLLAQDEEGDTLLHLFAARGLRWAAYAAAEVLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNSGVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPVHLLRPGPGPEGLRQLLKRSRVAPPGLSS

Tissue specificity:

Induction:

Developmental stage:

Protein families:NF-kappa-B inhibitor family


   💬 WhatsApp