NSG2_HUMAN   Q9Y328


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y328

Recommended name:Neuronal vesicle trafficking-associated protein 2

EC number:

Alternative names:(Neuron-specific protein family member 2) (Protein p19) (Hmp19)

Cleaved into:

GeneID:51617

Gene names  (primary ):NSG2

Gene names  (synonym ):CALY3

Gene names  (ORF ):

Length:171

Mass:19085

Sequence:MVKLNSNPSEKGTKPPSVEDGFQTVPLITPLEVNHLQLPAPEKVIVKTRTEYQPEQKNKGKFRVPKIAEFTVTILVSLALAFLACIVFLVVYKAFTYDHSCPEGFVYKHKRCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH

Tissue specificity:

Induction:

Developmental stage:

Protein families:NSG family


   💬 WhatsApp