NDUCR_HUMAN   E9PQ53


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:E9PQ53

Recommended name:NADH dehydrogenase [ubiquinone] 1 subunit C2, isoform 2

EC number:

Alternative names:(NDUFC2-KCTD14 readthrough transcript protein)

Cleaved into:

GeneID:100532726

Gene names  (primary ):NDUFC2-KCTD14

Gene names  (synonym ):

Gene names  (ORF ):

Length:114

Mass:13408

Sequence:MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDVYCCGAERRG

Tissue specificity:

Induction:

Developmental stage:

Protein families:Complex I NDUFC2 subunit family


   💬 WhatsApp