NDKB_HUMAN P22392
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P22392
Recommended name：Nucleoside diphosphate kinase B
EC number：EC:2.7.4.6
Alternative names：(NDK B) (NDP kinase B) (C-myc purine-binding transcription factor PUF) (Histidine protein kinase NDKB) (nm23-H2)
Cleaved into：
GeneID：4831
Gene names (primary )：NME2
Gene names (synonym )：NM23B
Gene names (ORF )：
Length：152
Mass：17298
Sequence：MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Tissue specificity：Isoform 1 and isoform 3 are ubiquitously expressed. {ECO:0000269|PubMed:16442775}.
Induction：
Developmental stage：
Protein families：NDK family