NDKA_HUMAN P15531
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P15531
Recommended name:Nucleoside diphosphate kinase A
EC number:EC:2.7.4.6
Alternative names:(NDK A) (NDP kinase A) (Granzyme A-activated DNase) (GAAD) (Metastasis inhibition factor nm23) (NM23-H1) (Tumor metastatic process-associated protein)
Cleaved into:
GeneID:4830
Gene names (primary ):NME1
Gene names (synonym ):NDPKA NM23
Gene names (ORF ):
Length:152
Mass:17149
Sequence:MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Tissue specificity:Isoform 1 is expressed in heart, brain, placenta, lung, liver, skeletal muscle, pancreas, spleen and thymus. Expressed in lung carcinoma cell lines but not in normal lung tissues. Isoform 2 is ubiquitously expressed and its expression is also related to tumor differentiation. {ECO:0000269|PubMed:10512675, ECO:0000269|PubMed:12601555, ECO:0000269|PubMed:16442775}.
Induction:
Developmental stage:
Protein families:NDK family