NDK6_HUMAN O75414
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O75414
Recommended name：Nucleoside diphosphate kinase 6
EC number：EC:2.7.4.6
Alternative names：(NDK 6) (NDP kinase 6) (Inhibitor of p53-induced apoptosis-alpha) (IPIA-alpha) (nm23-H6)
Cleaved into：
GeneID：10201
Gene names (primary )：NME6
Gene names (synonym )：
Gene names (ORF )：
Length：186
Mass：21142
Sequence：MASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA
Tissue specificity：Expressed at a moderately low level in many tissues. Most abundant in kidney, prostate, ovary, intestine, and spleen.
Induction：
Developmental stage：
Protein families：NDK family