MTD2L_HUMAN   Q9H903


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H903

Recommended name:Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2

EC number:EC:1.5.1.15

Alternative names:(NADP-dependent methylenetetrahydrofolate dehydrogenase 2-like protein) (MTHFD2-like) [Includes: NAD-dependent methylenetetrahydrofolate dehydrogenase ; Methenyltetrahydrofolate cyclohydrolase ]

Cleaved into:

GeneID:441024

Gene names  (primary ):MTHFD2L

Gene names  (synonym ):

Gene names  (ORF ):

Length:347

Mass:37315

Sequence:MTVPVRGFSLLRGRLGRAPALGRSTAPSVRAPGEPGSAFRGFRSSGVRHEAIIISGTEMAKHIQKEIQRGVESWVSLGNRRPHLSIILVGDNPASHTYVRNKIRAASAVGICSELILKPKDVSQEELLDVTDQLNMDPRVSGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTPKEQLKIHTQLADIIIVAAGIPKLITSDMVKEGAAVIDVGINYVHDPVTGKTKLVGDVDFEAVKKKAGFITPVPGGVGPMTVAMLLKNTLLAAKKIIY

Tissue specificity:Isoform 1, isoform 4 and isoform 5 are expressed in brain and placenta. {ECO:0000269|PubMed:21163947}.

Induction:

Developmental stage:

Protein families:Tetrahydrofolate dehydrogenase/cyclohydrolase family


   💬 WhatsApp