NKAI1_HUMAN   Q4KMZ8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4KMZ8

Recommended name:Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1

EC number:

Alternative names:(Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 1) (Protein FAM77C)

Cleaved into:

GeneID:79570

Gene names  (primary ):NKAIN1

Gene names  (synonym ):FAM77C

Gene names  (ORF ):

Length:207

Mass:23552

Sequence:MGKCSGRCTLVAFCCLQLVAALERQIFDFLGYQWAPILANFLHIMAVILGIFGTVQYRSRYLILYAAWLVLWVGWNAFIICFYLEVGQLSQDRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYVSKVFLEEEDSFDFIGGFDSYGYQAPQKTSHLQLQPLYTSG

Tissue specificity:

Induction:

Developmental stage:

Protein families:NKAIN family


   💬 WhatsApp