ATNG_HUMAN   P54710


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P54710

Recommended name:Sodium/potassium-transporting ATPase subunit gamma

EC number:

Alternative names:(Na(+)/K(+) ATPase subunit gamma) (FXYD domain-containing ion transport regulator 2) (Sodium pump gamma chain)

Cleaved into:

GeneID:486

Gene names  (primary ):FXYD2

Gene names  (synonym ):ATP1C ATP1G1

Gene names  (ORF ):

Length:66

Mass:7283

Sequence:MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

Tissue specificity:Expressed in the distal convoluted tubule in the kidney. Found on basolateral membranes of nephron epithelial cells.

Induction:

Developmental stage:

Protein families:FXYD family


   💬 WhatsApp