VPRE3_HUMAN Q9UKI3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UKI3
Recommended name：Pre-B lymphocyte protein 3
EC number：
Alternative names：(N27C7-2) (Protein VPreB3)
Cleaved into：
GeneID：29802
Gene names (primary )：VPREB3
Gene names (synonym )：
Gene names (ORF )：UNQ355/PRO619
Length：123
Mass：13710
Sequence：MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP
Tissue specificity：Expressed in B-cell precursors. Expressed in fetal liver, bone marrow, spleen and lymph node.
Induction：
Developmental stage：
Protein families：Immunoglobulin superfamily