PFD5_HUMAN   Q99471


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99471

Recommended name:Prefoldin subunit 5

EC number:

Alternative names:(Myc modulator 1) (c-Myc-binding protein Mm-1)

Cleaved into:

GeneID:5204

Gene names  (primary ):PFDN5

Gene names  (synonym ):MM1 PFD5

Gene names  (ORF ):

Length:154

Mass:17328

Sequence:MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA

Tissue specificity:Highly expressed in pancreas and skeletal muscle and moderately in other tissues.

Induction:

Developmental stage:

Protein families:Prefoldin subunit alpha family


   💬 WhatsApp