CCL28_HUMAN Q9NRJ3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NRJ3
Recommended name:C-C motif chemokine 28
EC number:
Alternative names:(Mucosae-associated epithelial chemokine) (MEC) (Protein CCK1) (Small-inducible cytokine A28)
Cleaved into:
GeneID:56477
Gene names (primary ):CCL28
Gene names (synonym ):SCYA28
Gene names (ORF ):
Length:127
Mass:14280
Sequence:MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
Tissue specificity:Preferentially expressed by epithelial cells of diverse tissues including normal and pathological colon, salivary gland, mammary gland, trachea and rectum. Also found in prostate, spleen, thyroid, psoriasis skin and in lower levels in peripheral blood leukocytes, small intestine, Peyer patches, stomach and normal skin.
Induction:
Developmental stage:
Protein families:Intercrine beta (chemokine CC) family