MT3_HUMAN P25713
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P25713
Recommended name：Metallothionein-3
EC number：
Alternative names：(MT-3) (GIFB) (GIF) (Growth inhibitory factor) (Metallothionein-III) (MT-III)
Cleaved into：
GeneID：4504
Gene names (primary )：MT3
Gene names (synonym )：
Gene names (ORF )：
Length：68
Mass：6927
Sequence：MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ
Tissue specificity：Abundant in a subset of astrocytes in the normal human brain, but greatly reduced in the Alzheimer disease (AD) brain.
Induction：
Developmental stage：
Protein families：Metallothionein superfamily, Type 1 family