RT36_HUMAN P82909
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P82909
Recommended name：28S ribosomal protein S36, mitochondrial
EC number：
Alternative names：(MRP-S36) (S36mt) (Alpha-ketoglutarate dehydrogenase component 4)
Cleaved into：
GeneID：92259
Gene names (primary )：MRPS36
Gene names (synonym )：KGD4
Gene names (ORF )：DC47
Length：103
Mass：11466
Sequence：MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE
Tissue specificity：
Induction：
Developmental stage：
Protein families：