RT35_HUMAN P82673
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P82673
Recommended name：28S ribosomal protein S35, mitochondrial
EC number：
Alternative names：(MRP-S35) (S35mt) (28S ribosomal protein S28, mitochondrial) (MRP-S28) (S28mt) (Mitochondrial small ribosomal subunit protein mS35)
Cleaved into：
GeneID：60488
Gene names (primary )：MRPS35
Gene names (synonym )：MRPS28
Gene names (ORF )：HDCMD11P MDS023 PSEC0213
Length：323
Mass：36844
Sequence：MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT
Tissue specificity：
Induction：
Developmental stage：
Protein families：Mitochondrion-specific ribosomal protein mS35 family