RT33_HUMAN   Q9Y291


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y291

Recommended name:28S ribosomal protein S33, mitochondrial

EC number:

Alternative names:(MRP-S33) (S33mt) (Mitochondrial small ribosomal subunit protein mS33)

Cleaved into:

GeneID:51650

Gene names  (primary ):MRPS33

Gene names  (synonym ):

Gene names  (ORF ):CGI-139 PTD003

Length:106

Mass:12629

Sequence:MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRAAKRK

Tissue specificity:

Induction:

Developmental stage:

Protein families:Mitochondrion-specific ribosomal protein mS33 family


   💬 WhatsApp