RT25_HUMAN P82663
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P82663
Recommended name：28S ribosomal protein S25, mitochondrial
EC number：
Alternative names：(MRP-S25) (S25mt) (Mitochondrial small ribosomal subunit protein mS25)
Cleaved into：
GeneID：64432
Gene names (primary )：MRPS25
Gene names (synonym )：RPMS25
Gene names (ORF )：
Length：173
Mass：20116
Sequence：MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD
Tissue specificity：
Induction：
Developmental stage：
Protein families：Mitochondrion-specific ribosomal protein mS25 family