RT21_HUMAN P82921
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P82921
Recommended name：28S ribosomal protein S21, mitochondrial
EC number：
Alternative names：(MRP-S21) (S21mt) (Mitochondrial small ribosomal subunit protein bS21m)
Cleaved into：
GeneID：54460
Gene names (primary )：MRPS21
Gene names (synonym )：RPMS21
Gene names (ORF )：MDS016
Length：87
Mass：10689
Sequence：MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCCRRQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC
Tissue specificity：
Induction：
Developmental stage：
Protein families：Bacterial ribosomal protein bS21 family