RT17_HUMAN   Q9Y2R5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y2R5

Recommended name:28S ribosomal protein S17, mitochondrial

EC number:

Alternative names:(MRP-S17) (S17mt) (Mitochondrial small ribosomal subunit protein uS17m)

Cleaved into:

GeneID:51373

Gene names  (primary ):MRPS17

Gene names  (synonym ):RPMS17

Gene names  (ORF ):HSPC011

Length:130

Mass:14502

Sequence:MSVVRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTTYLESPLSSETTQLSKNLEELNISSAQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:Universal ribosomal protein uS17 family


   💬 WhatsApp