RT15_HUMAN P82914
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P82914
Recommended name：28S ribosomal protein S15, mitochondrial
EC number：
Alternative names：(MRP-S15) (S15mt) (Mitochondrial small ribosomal subunit protein uS15m)
Cleaved into：
GeneID：64960
Gene names (primary )：MRPS15
Gene names (synonym )：RPMS15
Gene names (ORF )：DC37
Length：257
Mass：29842
Sequence：MLRVAWRTLSLIRTRAVTQVLVPGLPGGGSAKFPFNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRKKMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIPKTLKDSQ
Tissue specificity：
Induction：
Developmental stage：
Protein families：Universal ribosomal protein uS15 family