RT14_HUMAN   O60783


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O60783

Recommended name:28S ribosomal protein S14, mitochondrial

EC number:

Alternative names:(MRP-S14) (S14mt) (Mitochondrial small ribosomal subunit protein uS14m)

Cleaved into:

GeneID:63931

Gene names  (primary ):MRPS14

Gene names  (synonym ):

Gene names  (ORF ):

Length:128

Mass:15139

Sequence:MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW

Tissue specificity:

Induction:

Developmental stage:

Protein families:Universal ribosomal protein uS14 family


   💬 WhatsApp