RT14_HUMAN O60783
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O60783
Recommended name:28S ribosomal protein S14, mitochondrial
EC number:
Alternative names:(MRP-S14) (S14mt) (Mitochondrial small ribosomal subunit protein uS14m)
Cleaved into:
GeneID:63931
Gene names (primary ):MRPS14
Gene names (synonym ):
Gene names (ORF ):
Length:128
Mass:15139
Sequence:MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW
Tissue specificity:
Induction:
Developmental stage:
Protein families:Universal ribosomal protein uS14 family