PAQR8_HUMAN Q8TEZ7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8TEZ7
Recommended name：Membrane progestin receptor beta
EC number：
Alternative names：(mPR beta) (Lysosomal membrane protein in brain 1) (Membrane progesterone P4 receptor beta) (Membrane progesterone receptor beta) (Progesterone and adipoQ receptor family member 8) (Progestin and adipoQ receptor family member 8) (Progestin and adipoQ receptor family member VIII)
Cleaved into：
GeneID：85315
Gene names (primary )：PAQR8
Gene names (synonym )：C6orf33 LMPB1 MPRB
Gene names (ORF )：
Length：354
Mass：40464
Sequence：MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS
Tissue specificity：Highly expressed in the hypothalamus (PubMed:23161870). Also expressed in spinal cord, kidney and testis. {ECO:0000269|PubMed:11676489, ECO:0000269|PubMed:12601167, ECO:0000269|PubMed:16044242, ECO:0000269|PubMed:23161870}.
Induction：
Developmental stage：
Protein families：ADIPOR family