SIM20_HUMAN Q8N5G0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8N5G0
Recommended name:Small integral membrane protein 20
EC number:
Alternative names:(Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 7 kDa) (MITRAC7)
Cleaved into:Phoenixin-14 (PNX-14); Phoenixin-20 (PNX-20)
GeneID:389203
Gene names (primary ):SMIM20
Gene names (synonym ):C4orf52 MITRAC7
Gene names (ORF ):
Length:67
Mass:7702
Sequence:MSRNLRTALIFGGFISLIGAAFYPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK
Tissue specificity:Expressed in the ovary, specifically in granulosa cells of follicles that have passed the primary stage and in oocytes (at protein level). {ECO:0000269|PubMed:30933929}.
Induction:
Developmental stage:
Protein families: