COA1_HUMAN   Q9GZY4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9GZY4

Recommended name:Cytochrome c oxidase assembly factor 1 homolog

EC number:

Alternative names:(Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 15 kDa)

Cleaved into:

GeneID:55744

Gene names  (primary ):COA1

Gene names  (synonym ):C7orf44 MITRAC15

Gene names  (ORF ):

Length:146

Mass:16694

Sequence:MMWQKYAGSRRSMPLGARILFHGVFYAGGFAIVYYLIQKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE

Tissue specificity:

Induction:

Developmental stage:

Protein families:COA1 family


   💬 WhatsApp