S2551_HUMAN Q9H1U9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9H1U9
Recommended name：Mitochondrial nicotinamide adenine dinucleotide transporter SLC25A51
EC number：
Alternative names：(Mitochondrial NAD(+) transporter SLC25A51) (Mitochondrial carrier triple repeat protein 1) (Solute carrier family 25 member 51)
Cleaved into：
GeneID：92014
Gene names (primary )：SLC25A51
Gene names (synonym )：MCART1
Gene names (ORF )：
Length：297
Mass：33672
Sequence：MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITFPIQKVLFRQQLYGIKTRDAILQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLHKHVSAPEFATSGVAAVLAGTTEAIFTPLERVQTLLQDHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPILFRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFICGGLLGAMLGFLFFPINVVKTRIQSQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKVI
Tissue specificity：
Induction：
Developmental stage：
Protein families：Mitochondrial carrier (TC 2.A.29) family