S2538_HUMAN Q96DW6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96DW6
Recommended name:Mitochondrial glycine transporter
EC number:
Alternative names:(Mitochondrial glycine transporter GlyC) (Solute carrier family 25 member 38)
Cleaved into:
GeneID:54977
Gene names (primary ):SLC25A38
Gene names (synonym ):
Gene names (ORF ):
Length:304
Mass:33566
Sequence:MIQNSRPSLLQPQDVGDTVETLMLHPVIKAFLCGSISGTCSTLLFQPLDLLKTRLQTLQPSDHGSRRVGMLAVLLKVVRTESLLGLWKGMSPSIVRCVPGVGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTRYESGKYGYESIYAALRSIYHSEGHRGLFSGLTATLLRDAPFSGIYLMFYNQTKNIVPHDQVDATLIPITNFSCGIFAGILASLVTQPADVIKTHMQLYPLKFQWIGQAVTLIFKDYGLRGFFQGGIPRALRRTLMAAMAWTVYEEMMAKMGLKS
Tissue specificity:Preferentially expressed in erythroid cells. {ECO:0000269|PubMed:19412178}.
Induction:
Developmental stage:
Protein families:Mitochondrial carrier (TC 2.A.29) family, SLC25A38 subfamily