MFI_HUMAN   Q8NCR3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8NCR3

Recommended name:Protein MFI

EC number:

Alternative names:(Mitochondrial fission factor interactor)

Cleaved into:

GeneID:160140

Gene names  (primary ):MFI

Gene names  (synonym ):C11orf65

Gene names  (ORF ):

Length:313

Mass:36720

Sequence:MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQIVKYINPKEAELLDAAAGIHVRFRLGGVKFPPDIYYKIFTHRPIEDLCANSPRNYAKLPAKHTSHNKNDHLQEEDHSGWYHRIENNGWRPVSDTFWLSTDGMVVEDKKESEFHFSKLKRRQDLEKKRKLRKIEWMRQMYYSGSLEAKSTHHETLGLIHTATKGLIRAFEDGGIDSVMEWEVDEVLNWTNTLNFDEYIASWKEIATSNSSANFKGFRFNQAQKNIYNYGGDISKMQMGIPDDTYYENVYQEPNVTRLTPDSTYGL

Tissue specificity:Enriched in the pancreatic beta cell and the testis and is expressed at low levels in other tissues tested. {ECO:0000269|PubMed:30059978}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp